Tuesday, July 29, 2008
Now I'm loving those fragrance oil. I bought a few from Daiso last Saturday. They are so colorful and lovely. I bought a pink basket as well, isn't it cute? The fragrance names are so cute as well they are such moon, rainbow, snow, wave, wind, I can't remember the rest.
Labels: MISC
Thursday, July 24, 2008
Okay, do you know what is after billion, trillion? Read below and you will learn "illion" family.
Name | Short scale (USA and Modern British) | Long scale (Continental Europe and/or Traditional British) | Authorities | |||||||
---|---|---|---|---|---|---|---|---|---|---|
AHD4[1] | COD[2] | OED2[3] | OEDnew[4] | RHD2[5] | SOED3[6] | W3[7] | UM[8] | |||
million | 106 | 106 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
milliard | 109 | ✓ | ✓ | ✓ | ✓ | |||||
billion | 109 | 1012 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ |
billiard | 1015 | [9] | [9] | ✓ | ||||||
trillion | 1012 | 1018 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ |
trilliard | 1021 | [9] | [9] | [9] | ✓ | |||||
quadrillion | 1015 | 1024 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
quintillion | 1018 | 1030 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
sextillion | 1021 | 1036 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
septillion | 1024 | 1042 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
octillion | 1027 | 1048 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
nonillion | 1030 | 1054 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
decillion | 1033 | 1060 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
undecillion | 1036 | 1066 | ✓ | ✓ | ✓ | ✓ | ||||
duodecillion | 1039 | 1072 | ✓ | ✓ | ✓ | ✓ | ||||
tredecillion | 1042 | 1078 | ✓ | ✓ | ✓ | ✓ | ||||
quattuordecillion | 1045 | 1084 | ✓ | ✓ | ✓ | ✓ | ||||
quindecillion (quinquadecillion) | 1048 | 1090 | ✓ | ✓ | ✓ | ✓ | ||||
sexdecillion (sedecillion) | 1051 | 1096 | ✓ | ✓ | ✓ | ✓ | ||||
septendecillion | 1054 | 10102 | ✓ | ✓ | ✓ | ✓ | ||||
octodecillion | 1057 | 10108 | ✓ | ✓ | ✓ | ✓ | ||||
novemdecillion (novendecillion) | 1060 | 10114 | ✓ | ✓ | ✓ | ✓ | ||||
vigintillion | 1063 | 10120 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
googol | 10100 | 10100 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | |
centillion | 10303 | 10600 | ✓ | ✓ | ✓ | ✓ | ||||
googolplex | 10googol | 1010100 | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ | ✓ |
Base -illion (short scale) | Value | U.S. (short scale) | Traditional British (long scale) | Traditional European (Peletier) (long scale) |
---|---|---|---|---|
1 | 106 | Million | Million | Million |
2 | 109 | Billion | Thousand million | Milliard |
3 | 1012 | Trillion | Billion | Billion |
4 | 1015 | Quadrillion | Thousand billion | Billiard |
5 | 1018 | Quintillion | Trillion | Trillion |
6 | 1021 | Sextillion | Thousand trillion | Trilliard |
7 | 1024 | Septillion | Quadrillion | Quadrillion |
8 | 1027 | Octillion | Thousand quadrillion | Quadrilliard |
9 | 1030 | Nonillion | Quintillion | Quintillion |
10 | 1033 | Decillion | Thousand quintillion | Quintilliard |
11 | 1036 | Undecillion | Sextillion | Sextillion |
12 | 1039 | Duodecillion | Thousand sextillion | Sextilliard |
13 | 1042 | Tredecillion | Septillion | Septillion |
14 | 1045 | Quattuordecillion | Thousand septillion | Septilliard |
15 | 1048 | Quindecillion | Octillion | Octillion |
16 | 1051 | Sexdecillion | Thousand octillion | Octilliard |
17 | 1054 | Septendecillion | Nonillion | Nonillion |
18 | 1057 | Octodecillion | Thousand nonillion | Nonilliard |
19 | 1060 | Novemdecillion | Decillion | Decillion |
20 | 1063 | Vigintillion | Thousand decillion | Decilliard |
21 | 1066 | Unvigintillion | Undecillion | Undecillion |
22 | 1069 | Duovigintillion | Thousand undecillion | Undecilliard |
23 | 1072 | Tresvigintillion | Duodecillion | Duodecillion |
24 | 1075 | Quattuorvigintillion | Thousand duodecillion | Duodecilliard |
25 | 1078 | Quinquavigintillion | Tredecillion | Tredecillion |
26 | 1081 | Sesvigintillion | Thousand tredecillion | Tredecilliard |
27 | 1084 | Septemvigintillion | Quattuordecillion | Quattuordecillion |
28 | 1087 | Octovigintillion | Thousand quattuordecillion | Quattuordecilliard |
29 | 1090 | Novemvigintillion | Quindecillion | Quindecillion |
30 | 1093 | Trigintillion | Thousand quindecillion | Quindecilliard |
31 | 1096 | Untrigintillion | Sexdecillion | Sexdecillion |
32 | 1099 | Duotrigintillion | Thousand sexdecillion | Sexdecilliard |
N/A | 10100 | Ten duotrigintillion (also googol) | Ten thousand sexdecillion | Ten sexdecilliard |
33 | 10102 | Trestrigintillion | Septendecillion | Septendecillion |
34 | 10105 | Quattuortrigintillion | Thousand septendecillion | Septendecilliard |
35 | 10108 | Quinquatrigintillion | Octodecillion | Octodecillion |
36 | 10111 | Sestrigintillion | Thousand octodecillion | Octodecilliard |
37 | 10114 | Septentrigintillion | Novemdecillion | Novemdecillion |
38 | 10117 | Octotrigintillion | Thousand novemdecillion | Novemdecilliard |
39 | 10120 | Noventrigintillion | Vigintillion | Vigintillion |
40 | 10123 | Quadragintillion[16] | Thousand vigintillion | Vigintilliard |
50 | 10153 | Quinquagintillion | Thousand quinquavigintillion | Quinquavigintilliard |
60 | 10183 | Sexagintillion | Thousand trigintillion | Trigintilliard |
70 | 10213 | Septuagintillion | Thousand quinquatrigintillion | Quinquatrigintilliard |
80 | 10243 | Octogintillion | Thousand quadragintillion | Quadragintilliard |
90 | 10273 | Nonagintillion | Thousand quinquaquadragintillion | Quinquaquadragintilliard |
100 | 10303 | Centillion | Thousand quinquagintillion | Quinquagintilliard |
101 | 10306 | Uncentillion | Unquinquagintillion | Unquinquagintillion |
102 | 10309 | Duocentillion | Thousand unquinquagintillion | Unquinquagintilliard |
103 | 10312 | Trescentillion | Duoquinquagintillion | Duoquinquagintillion |
110 | 10333 | Decicentillion | Thousand quinquaquinquagintillion | Quinquaquinquagintilliard |
121 | 10366 | Unviginticentillion | Unsexagintillion | Unsexagintillion |
130 | 10393 | Trigintacentillion | Thousand quinquasexagintillion | Quinquasexagintilliard |
140 | 10423 | Quadragintacentillion | Thousand septuagintillion | Septuagintilliard |
150 | 10453 | Quinquagintacentillion | Thousand quinquaseptuagintillion | Quinquaseptuagintilliard |
160 | 10483 | Sexagintacentillion | Thousand octogintillion | Octogintilliard |
170 | 10513 | Septuagintacentillion | Thousand quinquaoctogintillion | Quinquaoctogintilliard |
180 | 10543 | Octogintacentillion | Thousand nonagintillion | Nonagintilliard |
190 | 10573 | Nonagintacentillion | Thousand quinquanonagintillion | Quinquanonagintilliard |
200 | 10603 | Ducentillion | Thousand centillion | Centilliard |
300 | 10903 | Trecentillion | Thousand quinquagintacentillion | Quinquagintacentilliard |
400 | 101203 | Quadringentillion | Thousand ducentillion | Ducentilliard |
500 | 101503 | Quingentillion | Thousand quinquagintaducentillion | Quinquagintaducentilliard |
600 | 101803 | Sescentillion | Thousand trecentillion | Trecentilliard |
700 | 102103 | Septingentillion | Thousand quinquagintatrecentillion | Quinquagintatrecentilliard |
800 | 102403 | Octingentillion | Thousand quadringentillion | Quadringentilliard |
900 | 102703 | Nongentillion | Thousand quinquagintaquadringentillion | Quinquagintaquadringentilliard |
1000 | 103003 | Thousand quingentillion | Quingentilliard | |
1010100 | Googolplex |
source :wiki
Labels: knowledge
Sunday, July 20, 2008
Happy Birthday to my brother KLT. 21st Birthday. Welcome to adult world.
(I have to maintain S$500 average everyday for his bank account in every month =/ )
Labels: birthday
Thursday, July 17, 2008
Now I'm playing this Big 2.5 game at Viwawa. It is fun. Playing card is fun. There has mahjong and some other games as well. It is playing with online players.
Labels: useful website
Tuesday, July 15, 2008
Yesterday, it was quiz but so called mid-term test though. I just looked through about coding of visual basic. I hate reading those theory part. I thought short questions should come out in drawing diagram which is not much problem to me.
But when I read paper of short questions, look question 1, I was like "Sh!t!", question 2 "Darn", question 3 "Oh, no", question 4 "Gosh, what the heck?". I answered back through from last questions. Total is 6 questions. But the last question is about 15 marks. I answered for 15 marks and 3 marks. I skip for 9 marks totally. Hee! I don't mean I would get full mark in what I answered too. Wish me luck.
It has been quite long that I studied and I took exam.
Exam = Nightmare
Labels: Myself
Friday, July 11, 2008
The family of Sean from Jinusean, Korean Hip Hop group, is like so cute. I love Jinusean. His babies are like super ghetto. Isn't it too good to be a daughter of famous and respectable rapper?
Look at the matching shoes. They are oh-so-cute.
source : soompi forum
Labels: Korean Celebrities
Wednesday, July 9, 2008
I found a few fun stuffs.
sourceWhat is the world's longest place name?
A little village in Wales boasts the longest place name at 58 letters:
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch...
...But New Zealand makes the same claim with a hill containing 92 letters:
Tetaumatawhakatangihangakoauaotamateaurehaeaturipuk
apihimaungahoronukupokaiwhenuaakitanarahu...
...But after some further digging we found the winner to be Bangkok. OK, so that's only 7 letters, but the official ceremonial name of Bangkok is Krung Thep Mahanakhon for short meaning 'City of Angels'.
The full name of Bangkok has many variations in spelling but we found what is believed to be the official spelling coming in at 163 letters:
Krungthepmahanakornamornratanakosinmahintarayutthaya
mahadilokphopnopparatrajathaniburiromudomrajaniwesmaha
satharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
Just imagine that I live in that Wales village. When people ask me "where do you live? I will be like " @#^$&*#&%!&# "
The signboard's length, it might be even wider than my bedroom.
Just copy and paste of that name and find more in google
What is the longest book ever written in the world?
Long long ago in a country far far away...During the Ming Dynasty at least 3,000 scholars spent 4 years, beginning in 1403, to work on the Yongle Dadian, an encyclopedia with 11,095 volumes and 22,877 chapters.
There are an estimated 370 million Chinese characters used.
The longest book ever written - Yongle Dadian
Gosh, 22,877 chapters? Now I'm merely surviving just for like 10 chapters.
So what exactly is the longest car in the world?
Length: 30.5 Meters or 100 Feet
Type: Limousine
Designer: Jay Ohrberg of Burbank California
Features: Includes a swimming pool with a diving board and a king size water bed.
Woohoo, I wish I want to take a ride on it. This car looks like it has more than 20 wheels.
What is the world's longest fish name?
If you're looking for fish with long names you'd better get out your scuba gear and head to Hawaii, that where the fish with the world's longest name lives.
Now you may be thinking you're smart and figure the answer is the trigger fish which, by it's Hawaiian name is called humuhumunukUnukuapuaa, but you are wrong.
The trophy for the longest fish name goes to the longnose butterflyfish, better know to Hawaiians as lauwiliwilinukunukuoioi.
Here is your chance to redeem yourself: say lauwiliwilinukunukuoioi 5 times fast.
Lauwiliwilinukunukuoioi
What is the longest job title in the world?
London, England News Ad:
Wanted: Temporary part-time libraries North-West inter-library loan business unit administration assistant.
As best we can figure out, they want a part time librarian temporarily.
Seems in the UK 70% of people prefer a grander job title over a pay raise. The applicants for this job will probably be working for free.
This is sure not enough space for job title when I need to fill form.
What is the world's longest name of a lake?
A short answer: Lake Webster, Massachusetts.
We know, you didn't come here for the short answer. Lake Webster as called by the Nipmucks has a much longer name, in fact a few so take your pick:
Chargogagogmanchargogagogcharbunagungamog
41 letters
Chargoggagoggmanchauggagoggchaubunagungamogg
44 letters
Chargoggagoggmanchauggagoggchabunagungamaugg
44 letters
Chargoggagoggmanchauggagoggchaubunagungamaugg
45 letters
Who has the longest last name in the world?
Finding this one out was a lot harder then we thought, but here is what we came up with:
At 21 letters we found this Gaelic surname:
MacGhilleseatheanaich
In 1996 Guinness listed this 17 letter surname as the longest English surname:
Featherstonehaugh
Adolph Blaine Charles David Earl Frederick Gerald Hubert Irvin John Kenneth Lloyd Martin Nero
Oliver Paul Quincy Randolph Sherman Thomas Uncas Victor William Xerxes Yancy Zeus
Wolfeschlegelsteinhausenbergerdorff
So what is the longest movie title ever?
This is an easy one:
Title: Night of the Day of the Dawn of the Son of the Bride of the Return of the Revenge of the Terror of the Attack of the Evil, Mutant, Alien, Flesh Eating, Hellbound, Zombified Living Dead Part 2: In Shocking 2-D
Director: Lowell Mason
Year: 1991
Words in title: 41
Characters in title: 208 including spaces, 168 without
Notes: Basically this movie is a remake of 'Night of the Living Dead' with a new soundtrack added.
Who has the longest neck in the world?
A custom of the Padaung Tribe of Burma is for their women to elongate their necks by inserting more and more copper coils between their head and shoulders.
The longest extension on record is 40 cm. or 15 3/4" inches.
Yay, world record for Myanmar. I know they do really have long neck. I wonder how they sleep.
What is the world longest's paint title?
The world's longest painting title goes to a painting painted by Mody Thomas and the painting can be seen here.
In all the title contains 38 words, 308 characters, not counting spaces and if you wish to count the spaces then it paints in at an oily 345 characters.
So, without dragging this out any longer, here is the title:
The affection, admiration, abundance, compassion, composure, cheerfulness, contentment, courage, delight, excitement, fulfillment, gratefulness, harmony, interest, intimacy, integrity, modesty, relaxation and the togetherness of lovers standing under the bountifully elegant and outstandingly vivacious tree of goodness, richness and enchantmentSo what was the longest jail sentence in the world?
Did they deserve it? You be the judge.
Name: | Gabriel March Grandos |
Crime: | Confidense tricksters |
Requested sentence: | 384,912 Years |
Given sentence: | 7,109 Years |
Date: | March 11 1972 |
More: He was charged with 42,768 instances of failing to deliver letters. I think I know how we got the term 'Postal' now.
Name: | Dudley Wayne |
Crime: | Murder |
Given sentence: | 10,000 Years |
Date: | 1981 |
More: He was sentenced for murdering his wife, mother-in-law and a college student.
Even more: Nowadays he'd get a slap on the wrist and a 'don't do it again' lecture.
Why don't they just give him death sentence? Will he still be in jail even though he is ghost or something?
So what was the longest roller coaster in the world?
Name: | Steel Dragon |
Location: | Nagashima Spaland, Japan |
Date opened: | August 01 2000 |
Length: | 2,479 Meters - 8,133 Feet |
Speed: | 95 MPH |
Height: | 318 Feet |
Biggest drop: | 307 Feet |
Notes: This roller coaster set 4 world records: Tallest, Longest, Fastest and Greatest Drop.
Worlds longest roller coaster - Steel Dragon
What is the world longest street's name?
We had a bit of a tough time finding out this record but here goes.
We actually found two streets with the what we believe to be the world's longest name:
-
Bolderwood Arboretum Ornamental Drive is located in New Forest, Great Britain.
-
Northeast Kentucky Industrial Parkway is located in, you guessed it, Kentucky.
Both street names contain 34 letters and 37 characters if you count spaces are are the longest street names in their respective countries.
Thanks to a correction we were sent the name of a street in Poland containing 65 letters or 72 characters counting spaces, the world's longest street name being:
Dwudziestego Pierwszego Praskiego Pułku Piechoty imienia Dzieci Warszawy.What is the world's longest song title?
Swedish group Rednex are the proud owners of the world's longest song title.
At 52 words and 305 characters, (including spaces) here it is:
The Sad But True Story Of Ray Mingus, The Lumberjack Of Bulk Rock City, And His Never Slacking Stribe In Exploiting The So Far Undiscovered Areas Of The Intention To Bodily Intercourse From The Opposite Species Of His Kind, During Intake Of All The Mental Condition That Could Be Derived From Fermentation
And here are the lyrics, just slightly longer than the title:
It's been a pretty long time, baby
But now, I'm back in town
It's time to leave your husband
Now you know that little clown
Last time we were seeing
Didn't you beg for more
It's OK with me as long
As you do it four on the floor
This is what I'm giving you, you'll get it all tonight
You will be my lover, but not my tender wife
I'll be harder than your husband, I'll be harder than your man
I'll hit you with my twenty inch until you can not stand
I'll be harder than your husband, I'll be harder than your man
I'll hit you with my twenty inch until you can not stand
I've missed the little North Pole
On the bottom of my twister
Here's the one-eyed-worm
Now you'll never be a sister
Well, it's time to leave now
You better walk her home
Don't forget you underwear
You look pretty stoned
This is what I'm giving you, you'll get it all tonight
You will be my lover, but not my tender wife
I'll be harder than your husband, I'll be harder than your man
I'll hit you with my twenty inch until you can not stand
I'll be harder than your husband, I'll be harder than your man
I'll hit you with my twenty inch until you can not stand
I'll be harder than your husband, I'll be harder than your man
I'll be harder than your husband, I'll be harder than your man
In 1987 Game Theory released their album, Lolita Nation, of which track #22 was titled:
All Clockwork and No Bodily Fluids Makes Hal a Dull Metal Humbert In Heaven Every Elephant Baby Wants to Be So Full of Sting Paul Simon in the Park with Canticle – But You Can't Pick Your Friends Vacuum Genesis DEFMACROS HOWSOMETH INGDOTIME SALENGTHS OMETHINGL ETBFOLLOW AAFTERNOO NGETPRESE NTMOMENTI FTHINGSWO NTALWAYSB ETHISWAYT BCACAUSEA BWASTEAFT ERNOONWHE NEQBMERET URNFROMSH OWLITTLEG REENPLACE 27
In all there are 59 words and 344 characters but the capitalized words are just fragments of LISP code so we'll leave it up to you to decide which song takes home the record.What is the world's longest TV?
The world's longest television can be found at the Hong Kong Jockey Club.
The Diamond Vision display was built by the Mitsubishi Electric Corporation and measures 70.4 meters or 231 feet long and 8 meters or 26 feet high.
The world's longest TV is about as long as a 747.
World's Longest TV
So what exactly is the longest word in the world?
It all depends on your point of view, but here goes:
Officially the longest word is 'floccinaucinihilipilification' at 29 characters, meaning 'the act of estimating as worthless'.
Then there's 'antidisestablishmentarianism' at 28 letters, meaning 'opposition to the disestablishment of the Church of England'. It is often considered the longest word as it has an actual meaning instead of being created just to be long.
Unofficially the longest word is 'pneumonoultramicroscopicsilicovolcanoconiosis' at 45 characters, meaning 'a lung disease'. It was created solely for the purpose of being the longest word, however, it does appear in a few dictionaries.
The longest place name is that of a hill in New Zealand at 85 characters:
TAUMATAWHAKATANGIHANGAKOAUAUOTAMATEATURIPU
KAKAPIKIMAUNGAHORONUKUPOKAIWHENUAKITANATAHU
The word with the most letters is a name of protein, as a name, it technically does not qualify as a word, but at 1913 characters, we just had to include it. Theoretically these names can contain an infinite amount of characters, but this one qualifies as it has actually been used in a medical journal.
methionylglutaminylarginyltyrosylglutamylserylleucyl phenylalanylalanylglutaminylleucyllysylglutamylarginyl lysylglutamylglycylalanylphenylalanylvalylprolylphenyl alanylvalylthreonylleucylglycylaspartylprolylglycylisol eucylglutamylglutaminylserylleucyllysylisoleucylaspartyl threonylleucylisoleucylglutamylalanylglycylalanylaspartyl alanylleucylglutamylleucylglycylisoleucylprolylphenyl alanylserylaspartylprolylleucylalanylaspartylglycylprolyl threonylisoleucylglutaminylasparaginylalanylthreonylleucyl arginylalanylphenylalanylalanylalanylglycylvalylthreonyl prolylalanylglutaminylcysteinylphenylalanylglutamyl methionylleucylalanylleucylisoleucylarginylglutaminyllysyl histidylprolylthreonylisoleucylprolylisoleucylglycylleucyl leucylmethionyltyrosylalanylasparaginylleucylvalylphenyl alanylasparaginyllysylglycylisoleucylaspartylglutamylphenyl alanyltyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylserylvalylleucylvalylalanylaspartylvalyl prolylvalylglutaminylglutamylserylalanylprolylphenylalanyl arginylglutaminylalanylalanylleucylarginylhistidylasparaginyl valylalanylprolylisoleucylphenylalanylisoleucylcysteinyl prolylprolylaspartylalanylaspartylaspartylaspartylleucyl leucylarginylglutaminylisoleucylalanylseryltyrosylglycyl arginylglycyltyrosylthreonyltyrosylleucylleucylserylarginyl alanylglycylvalylthreonylglycylalanylglutamylasparaginyl arginylalanylalanylleucylprolylleucylasparaginylhistidyl leucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginyl alanylalanylprolylprolylleucylglutaminylglycylphenylalanyl glycylisoleucylserylalanylprolylaspartylglutaminylvalyllysyl alanylalanylisoleucylaspartylalanylglycylalanylalanylglycyl alanylisoleucylserylglycylserylalanylisoleucylvalyllysylisol eucylisoleucylglutamylglutaminylhistidylasparaginylisoleucyl glutamylprolylglutamyllysylmethionylleucylalanylalanylleucyl lysylvalylphenylalanylvalylglutaminylprolylmethionyllysyl alanylalanylthreonylarginylserine
Okay, okay, this is totally junk. This is just like I'm writing astjiogjujljdioeuioeuyjodijgldgj. But acutally, you can copy and paste that methion-something and find in google.
Some trivia about different long english words
-
Longest word with all the vowels in order (23): Pancreaticoduodenostomy
-
Longest words that can be reversed (8):
stressed & desserts
-
Word with the longest run of vowels (4):
queuing
-
Longest word with 180 degree symmetry (5):
SWIMS
-
Longest word in which all letters appear twice (16):
Esophagographers
-
Longest word that can be typed with the left hand (12):
Stewardesses
-
Longest word with only one vowel (9):
strengths
-
Longest word to alternate consonants and vowels (27):
Honorificabilitudinitatibus
-
Longest word with letters in alphabetical order (8):
Aegilops
-
Longest word without a repeating letter (15):
uncopyrightable & dermatoglyphics
-
Word with the longest run of consonants (6):
latchstring
-
Longest one-syllable word (9):
screeched & strengths
Well, I learn somethings.
Not for world record, but it might be my longest blog post, lol?
Longest nonsense.
Hi, my name is *insert longest name*. I live in *insert longest place*. I work as *insert longest job title. My fave fish is *insert longest fish name*. My fave lake is *insert longest lake name*. I just finished watching this movie called *insert longest movie name*. My fave song is *insert longest song name*. My fave painting is *insert longest painting title*. One of my best friend lives in *insert longest street name*. My neighbour has *longest word* disease. His daughter needs this protein called *insert longest word (protein)*.
You can visit the longest url to see all those longest record. This post all credit to the longest url : http://thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com/
Labels: MISC
Tuesday, July 8, 2008
Perfumes
Ya, I love perfume. I still have Escada Pacific Paradise & Givenchy Very Irresistible. But when I'm getting perfume with good pricing. I can't stand not to get one. So I bought this Escada Sentiment's set. I know this is kinda old series from Escada. But the smell is great, my taste which is sweet.
And I bought this Ralph Lauren Polo Black for my brother as present. I used Polo Sport before and I love love it. I love Polo for men perfume.
Ok, here it is, the perfume warehouse sale is at Ubi. Ma Bon works around there, so she told me about it since she knows I like perfume.
Saturday, I went that warehouse sale again after my school. I just brought my friend there. I tried not to buy anymore. I know although I won't pretty use much, I still want to get all the perfumes I like (it gonna be long list). I just want to have all the collections.
Well after that perfume warehouse sale, I had dinner at Pizza Place with friend. This is second time. I love the food from there.
Friday, July 4, 2008
Beyond All Magic
Cast
Kim Soo Mi
Shim Hye Jin
Lee Da Hee
Lee Sang Woo
Synopsis
Nam-hee struggles to make a living selling fruit as she lives with her mom who thinks she is still a young girl (ill with Alzheimer’s) and her senseless daughter who only dreams of becoming an anchorwoman. One day, Joon, a mysterious guy appears before three eccentric women. Having more time together, Nam-hee who got tired of living feels at peace and her heart flutters for the first time through Joon. When Na-rae senses it, she is confused and gets jealous of mother’s love, but finally realizes that mom is also a woman. Thanks to Joon, a love messenger, they become slowly aware of true meaning of family...
My opinion
I want to watch this movie because it seem fun and comedy. Plus I like the Kim Soo Mi (grandma), she is so funny and she can act well. Shim Hye Jin (the mother), she is ok, I watched her drama "Come Back Soon Ae" before. And I really like the Lee Sang Woo (the actor). He is so cool. He isn't like oh so hot type. But he got his charm to me.
Gourmet
Kim Rae Won
Nam Sang Mi
Kim So Yun
Kwon Oh Joong
Synopsis
Sung Chan is a talented cook. He peddles food from his truck all over the country to discover the best and precious traditional Korean cuisines.
My 0pinion
I miss Kim Rae Won and Nam Sang Mi. So this is new drama I-must-watch.
Code Blue
Kurosagi
I watched Kurosagi drama. Now this come out as movie. Only cam version is out. So I'm waiting for DVD version to see more clearly of my Yamapi.
picture credit to : http://nhatkyviet.com/